Worlds Longest Word! ! !

Dont Ban Me

.: Longest Word :.

This is probably the longest word in the English Language :

Acetylseryltyrosylserylisoleucylthreonylserylprolylserylglutaminylphenylalanylvalylphenyl-
alanylleucylserylserylvalyltryptophylalanylaspartylprolylisoleucylglutamylleucylleucylasparaginyl-
valylcysteinylthreonylserylserylleucylglycylasparaginylglutaminylphenylalanylglutaminylthreonyl-
glutaminylglutaminylalanylarginylthreonylthreonylglutaminylvalylglutaminylglutaminyl-
phenylalanylserylglutaminylvalyltryptophyllysylprolylphenylalanylprolylglutaminylserylthreonylvalyl-
arginylphenylalanylprolylglycylaspartylvalyltyrosyllysylvalyltyrosylarginyltyrosylasparaginylalanyl-
valylleucylaspartylprolylleucylisoleucylthreonylalanylleucylleucylglycylthreonylphenylalanylaspartyl-
threonylarginylasparaginylarginylisoleucylisoleucylglutamylvalglutamylasparaginylglutaminyl-
glutaminylserylprolylthreonylthreonylalanylglutamylthreonylleucylaspartylalanylthreonyl-
arginylarginylvalylaspartylaspartylalanylthreonylvalylalanylisoleucylarginylserylalanyl-
asparaginylisoleucylasparaginylleucylvalylasparaginylglutamylleucylvalylarginylglycyl-
threonylglycylleucyltyrosylasparaginylglutaminylasparaginylthreonylphenylalanylglutamyl-
serylmethionylserylglycylleucylvalyltryptophylthreonylserylalanylprolylalanylserine."


It is the technical name for "Tobacco Mosaic Virus, Dahlemense Strain."

It is 1,185 letters long !

Big Chief

i fail to see the humour

Dont Ban Me

Its big its long, and makes absaloutley no sense!! Just like most jokes!
U want me to remove it?

Capt'n Midnight

S-mile-s there's a mile between the first and last letters....

Seriously the word above describing a protien with 150 amino acids does not even come close - the human genome has been sequenced and so it can be written as single word (or even longer if you want to assign more than a letter to each base or even longer to each atom in each base.)

BTW the human genome can be pulled down from project guttenberg

tman

side splitting stuff

(i think antidisestablishmentarianism (sp?) is the longest word in the dictionary btw)

Gordon

I was going to suggest that Capt'n Midnight!

But methinks the incorrectly spelled by me word would be
Floccinocinihilipilification. Which is the act of making things small. Gordon looked at the original post and said... "Who, check out the humour floccinocinihilipilification on that one!"

Pugsley

Originally posted by tman
side splitting stuff

(i think antidisestablishmentarianism (sp?) is the longest word in the dictionary btw)

Thats the longest word in the english dictionary, not neccessarily in the world.

Catsmokinpot

yeah i thought it was antidisestablishmentarianism

ykt0di9url7bc3

pi?

hells angels

Humour?????

GoneShootin

Victor

Originally posted by tman
(i think antidisestablishmentarianism (sp?) is the longest word in the dictionary btw)

How about antidisestablishmentarianisticly?

Originally posted by Pugsley
Thats the longest word in the english dictionary, not neccessarily in the world.

Yeah the Germans have the habit of making very long compound nouns (in particular) and something like 4,000 irregular verbs. :eek:

Benbaz

God, I can't wait to tell this cracker in the pub tonight!!! Now how does it go..................Acetylseryltyrosyls.......................

:rolleyes:

Capt'n Midnight

if you asume 11 characters per base pair - actually it can be longer 'cos I leaving out the deoxyribo- bit at the start

(must post this in science I suppose)

Sequences on
http://www.ibiblio.org/gutenberg/authors/human_genome_project.html - Beware all are large downloads (> 22 MB each)

eg: about 66 million characters long (where as the protein above would only be 150 characters long - see rules below.) - and even the name given above is too long - see below for std. protein abbreviations.

Each of the 66 million characters would be represented by
A Adenosine C Cytidine
G Guanosine T Ribosylthymine - average is 11 letters

66 * 11 = 726,000,000 letters long



see also
http://www.pbs.org/wgbh/nova/genome/dna.html


http://bj.portlandpress.co.uk/bj/bji2a.htm

Note on : Amino acids

The full residue names or the three-letter symbols are preferred to the one-letter symbols in the text (e.g. a phenylalanine residue at position 231 should be symbolized Phe-231 or Phe231 rather than F231). Either system may be used in sequences.

Alanine Ala A
Arginine Arg R
Asparagine Asn N
Aspartic acid Asp D
Aspartic acid or asparagine (undefined) Asx B
Cysteine Cys C
|
Cystine (half) Cys or Cys —
|
Glutamine Gln Q
Glutamic acid Glu E
Glutamic acid or glutamine (undefined) Glx Z
Glycine Gly G
Histidine His H
Hydroxylysine Hyl —
Hydroxyproline Hyp —
Isoleucine Ile I
Leucine Leu L
Lysine Lys K
Methionine Met M
Ornithine Orn —
Phenylalanine Phe F
Proline Pro P
Serine Ser S
Threonine Thr T
Tryptophan Trp W
Tyrosine Tyr Y
Unknown or 'other' Xaa X
Valine Val V

In polymers or sequences the three-letter symbols should be joined by hyphens if the sequence is known, or by commas if it is not; e.g.:

Gly-Ile-Gly-Phe(Gly,Tyr,Val,Ser)Leu-Val-Ala

represents an undecapeptide composed of four amino acids whose sequence has been established, four for which the sequence is unknown and then three in known sequence. The glycine on the left carries the free amino group and the alanine on the right the free carboxyl group. The prefix poly or the suffix subscript n may accompany these symbols to indicate polymers [see Biochem. J. (1972) 127, 753–756].

Special considerations apply to the spacing and punctuation of the one-letter symbols [see Biochem. J. (1984) 219, 366–368].


===================================
Nucleosides, nucleotides and polynucleotides

The symbols for ribonucleosides are as follows (the prefix r should be used if there is possible ambiguity):

A Adenosine C Cytidine
G Guanosine T Ribosylthymine
I Inosine U Uridine
X Xanthosine
5-Ribosyluracil (pseudouridine)

The 2´-deoxyribonucleosides are designated by the same symbols preceded by d, e.g.:

dA 2´-Deoxyribosyladenine
dT 2´-Deoxyribosylthymine (thymidine)
The letter p (for terminal phosphate only) or a hyphen (for phosphodiester group only) to the left of a nucleoside symbol indicates a 5´-phosphate; to the right it indicates a 3´-phosphate, e.g.:

pA-G 5´-Phosphoadenylyl(3´-5´)guanosine or guanylyl(5´-3´)adenosine 5´-phosphate
A-Gp Adenylyl(3´-5´)guanosine 3´-phosphate
d(A-T) Deoxyadenylyl(3´-5´)thymidine
A-G-cyclic-p or A-G > p Adenylyl(3´-5´)guanosine 2´,3´-phosphate

Other points of attachment may be indicated by numerals, e.g.:

A2´-5´G2´p Adenylyl(2´-5´)guanosine 2´-phosphate
A-G-(mixed 2´,3´)-p A mixture of A-Gp and A-G2´p


In sequences, oligonucleotides or polynucleotides the phosphate between nucleoside symbols is shown by a hyphen if the sequence is known, or by a comma if it is not, e.g.:

G-A-U(C2,U)Gp
indicates a heptanucleotide composed of three nucleotides of known sequence but with a trinucleotide of unknown sequence before the final Gp. The hyphens may be omitted.

For sequences that are repetitive or obscure, shorter forms may be used [see Biochem. J. (1972) 127, 753–756], e.g.:

poly(A) a simple homopolymer of A
poly(A3,C2) random co-polymer of A and C in 3:2 proportions
poly[d(A-T)] or poly(dA-dT) alternating co-polymer of dA and dT
poly(A,G,C,U) random co-polymer of A, G, C and U, proportions unspecified

frood4t2

not funny per se, but certainly amusing

dragon heart

"Floccinaucinihilipilification" which means "the act of estimating as worthless" is the longest non-medical word in the English language; it's 29 letters long.

Dr. Dre

How's about pneumonoultramicroscopicsilicovolcanoconiosis,
which it turns out isn't an actual real word at all, BBC messed up there.

Ah, what was that show called, catch word or something ?

BioHazRd

I think this is better suited to after hours

<moved>

Bio

solice

why in gods name would they call something that. could they not just call it flocky and have arefrence to all the necessary information in a book.
ppl need their heads examined

Irish_Ranger_IR

this tread will be as long??

*cough*

Capt'n Midnight

Or Mohawk indians.
But at least there has been no mention of Ms. M. Poppins.

Other longest words - aeon / infinity or mo
as in (Female voice)I'll be ready in a mo.

BTW: the original Anglo saxon word Moment meant a time span of about three minutes. - not the 1/10-1/16? of a second associated with blinking eyes .

=========================================

Iteration - see Iterataion
(ie. loop until understood)

Recursion - GIR Is Recursive.

Space Coyote

I've lost the will to live ...

Thorbar

Thorbar fights temptation to post up stupid joke...

Thorbar fails...

My langer is the biggest word in the world.

Capt'n Midnight

My langer is the biggest word in the world.

PH01

kyyhkyslakkahillotaatelipalmusunnuntaikävelykatujuhlakoristehedelmäkaramellimassatuotevalvontalaitteistotestauslaboratoriokäyttökertatulitikkuviinapiilohomokaasulasersädehoitokotikaljakimblemestaruussarjakuvaristikkokilpajuoksuhiekkaaavikkoluontoohjelmauusintavaalikokousedustusmenopaluuruuhkabussivuoropysäköinti
sakkolihakoukkuselkänahkavyöruusukasvimaamunajuustomaitorasvaimunestepintaalahuulipunakampelaverkkomahalaskuharjoitustyöaamukampapellavaöljykriisiapukeinolonkkalepolomarusketusrajatietoteollisuuskiinteistömarkkinointidiplomiinsinööriopiskelijaperinnemaisemaarkkitehtikiltaaktiivihiiliteräsbetonivalurautaristisiitoshärkäpizzamaustevoipaperiroskapostimerkkisavusaunavastaprotesti
marssivapautusliikevaihtoväliarvojoukkopakomatkaopaskoirakantakorttitaikatalvisotakunniajäsenetupuolikuivarehuviljaittakorpisuomaastohiihtoputkitiivistesilikonirintataskuvaraslähtöliukumiinakenttäkeitinvesihanasaariryhmätyömyyrävuosikurssikirjapainopistetulotukivarsikenkäkauppaopistoupseerikerhohuonepalveluammattikoulupoikatyttöenergiatalousaluelaajennustarvehierarkiakaaviosuunnittelupäätöspäivävientisulkuporttiteoriapohjakuntourheiluruutuässäpariluistelutyylituomaripelimiesvoimisteluvideokulmakarvakuonokoppalakkipäämääräalennustilataksimittarimatopurkkikeittoastiakaappipakastinyhdistelmälukkoseppähenkilötunnussanaleikkikalupakkipussieläinkoeponnistuslautakuntalakitekstiseikkailuleiritelttakangaspuujalkasienipiirakkareseptivihkopakkausmuovikuularuiskumaalaustarvikevarastohyllymetrilakuavainnaulakkovartiopäällikkötasogeometriavirhevaihtosähkökazoopillihousupukupellehyppylankakeräkaaliaivovuotosuojavaatekappalemyyntitykkilavatanssiaskelmoottoripyöräkoppisiemenperunapalstajakoviivaintegraalioperaattorialgebraoppilaitoskompleksilukusuoravetooikeusmurhaasevarikkopilttuu

http://www.hut.fi/~jpakkane/sana.html

Jeffy the Kitten says...